PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00573.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 25845.2 Da    PI: 4.8402
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00573.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien   rqvtfskRr+g+lKKA+EL vLCd++v v++fs++gkl+ey++
  Pahal.D00573.1  9 KRIENRVSRQVTFSKRRKGLLKKAHELAVLCDVDVGVVVFSERGKLFEYPN 59
                    79***********************************************95 PP

2K-box51.93.3e-1884160984
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesL.slkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                      ++ +++++  e+ +L++e+e+Lq ++    GedL+sL s+ eL +LeqqLe++l+k R++K+ell++  +elq k 
  Pahal.D00573.1  84 HCTDHQQQMIAEIGRLRREYEQLQASLMACTGEDLSSLtSVDELDELEQQLESALSKARARKDELLTSLDDELQLKI 160
                     6778899*******************************5689**************************999999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.557161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-37160IPR002100Transcription factor, MADS-box
CDDcd002655.71E-38272No hitNo description
SuperFamilySSF554554.19E-30284IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-1586158IPR002487Transcription factor, K-box
PROSITE profilePS5129712.24189177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKVEMKR IENRVSRQVT FSKRRKGLLK KAHELAVLCD VDVGVVVFSE RGKLFEYPNP  60
PASLTDLIRR YEAVTNTQLL QETHCTDHQQ QMIAEIGRLR REYEQLQASL MACTGEDLSS  120
LTSVDELDEL EQQLESALSK ARARKDELLT SLDDELQLKI NGNGRHGAAA VGVETEEIAE  180
PLPPSPSFAY LLKVKEKSAA STMLQLWPQA DDDDDDVGSG GGGGSGPPRG LQLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-16181186Myocyte-specific enhancer factor 2B
1tqe_R2e-16181186Myocyte-specific enhancer factor 2B
1tqe_Q2e-16181186Myocyte-specific enhancer factor 2B
1tqe_P2e-16181186Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN5524823e-45FN552482.1 Pennisetum glaucum AFLP fragment RQVTKKA2-4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002437421.14e-98hypothetical protein SORBIDRAFT_10g026690
SwissprotQ655V43e-57MAD30_ORYSJ; MADS-box transcription factor 30
TrEMBLK3XZ291e-105K3XZ29_SETIT; Uncharacterized protein
STRINGSi007187m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.41e-27MIKC_MADS family protein